PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G212400.1
Common NamePHAVU_002G212400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 97aa    MW: 11142.9 Da    PI: 10.8296
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G212400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-26959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+i+n s rqvtfskRr+g++KKA+ELS+LCda++a+i+fs t kl++y+s
  Phvul.002G212400.1  9 KKIDNISSRQVTFSKRRKGLFKKAQELSTLCDADIALIVFSATSKLFDYAS 59
                        68***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.469161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-31286IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-26323IPR002100Transcription factor, MADS-box
CDDcd002651.90E-36378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MTRKRIQIKK IDNISSRQVT FSKRRKGLFK KAQELSTLCD ADIALIVFSA TSKLFDYASS  60
SMQQVIERLD RHSAMHRSDR SYMELQVSFS NINLLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-21378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-21378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-21378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-21378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P1e-21178178Myocyte-specific enhancer factor 2B
1tqe_Q1e-21178178Myocyte-specific enhancer factor 2B
1tqe_R1e-21178178Myocyte-specific enhancer factor 2B
1tqe_S1e-21178178Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0993381e-100BT099338.1 Soybean clone JCVI-FLGm-13P11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159143.18e-64hypothetical protein PHAVU_002G212400g
SwissprotQ9FUY61e-36JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLV7CLT98e-64V7CLT9_PHAVU; Uncharacterized protein
STRINGGLYMA07G30040.22e-48(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-34MIKC_MADS family protein